Warning: Undefined array key "url" in /www/wwwroot/mnbt.11370829f/wp-content/plugins/wpforms-lite/src/Forms/IconChoices.php on line 127

Warning: Undefined array key "path" in /www/wwwroot/mnbt.11370829f/wp-content/plugins/wpforms-lite/src/Forms/IconChoices.php on line 128
(Asp³⁷)-Amyloid β-Protein (1-42) - Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

(Asp³⁷)-Amyloid β-Protein (1-42)

Home/Beta Amyloid Peptides/(Asp³⁷)-Amyloid β-Protein (1-42)
(Asp³⁷)-Amyloid β-Protein (1-42)Admin2020-12-18T11:47:38+00:00
Product Name (Asp³⁷)-Amyloid β-Protein (1-42)
Purity HPLC>95%
Description The G37D mutant does not show the aggregation behavior of WT Abeta42 nor its neurotoxicity.
Storage -20°C
References J.Kanski et al., Neurotox. Res., 4, 219 (2002)
Molecular Weight 4572.14
Sequence (One-Letter Code) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGVMVDGVVIA
Sequence (Three-Letter Code) H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Asp-Gly-Val-Val-Ile-Ala-OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

  • Ginsenoside Re
  • Semagacestat
  • Beta-Amyloid (1-42), Human
  • Beta-Amyloid (1-42), FAM-labeled, Human
  • [Met]-beta-Amyloid (1-42), 5-TAMRA labeled, Human
Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top