| Product Name | [Lys22]-beta-Amyloid (1-42), Italian Mutation, Human |
| Purity | HPLC>95% |
| Description | This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42). |
| Storage | -20°C |
| References | Masuda, Y. et al. Bioorg. Med. Chem. 13, 6803 (2005). |
| Molecular Weight | 4513.2 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Lys - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH |
[Lys22]-beta-Amyloid (1-42), Italian Mutation, HumanAdmin2020-12-18T13:20:47+00:00
