| Product Name | [Pro19]-beta-Amyloid (1-42); F19P beta-Amyloid (1-42), Human |
| Purity | HPLC>95% |
| Description | This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s. |
| Storage | -20°C |
| References | Bernstein, S. et al. J Am Chem Soc 127, 2075 (2005); O’Nuallain, B. and R Wetzel. Proc Natl Acad Sci USA 99, 1485 (2002). |
| Molecular Weight | 4464.1 |
| Sequence (One-Letter Code) | DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA |
| Sequence (Three-Letter Code) | H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Pro - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH |
[Pro19]-beta-Amyloid (1-42); F19P beta-Amyloid (1-42), HumanAdmin2020-12-18T13:22:05+00:00
