Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

BNP-32, human

Home/Catalog peptide/BNP-32, human
BNP-32, humanAdmin2021-01-04T11:59:23+00:00
Product Name BNP-32, human
Purity HPLC>95%
Description This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Storage -20°C
References Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Sudoh, T. et al. Nature 332, 78 (1988); Cheung, B. et al. JAMA 280, 1983 (1998); Struthers, A. BMJ 308, 1615 (1994); De Lemos, JA. et al. Lancet 362, 316 (2005); Kambayashi, Y. et al. Biochem. Biophys. Res. Commun. 159, 1427 (1989).
Molecular Weight 3464.1
Sequence (One-Letter Code) SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Sequence (Three-Letter Code) H - Ser - Pro - Lys - Met - Val - Gln - Gly - Ser - Gly - Cys - Phe - Gly - Arg - Lys - Met - Asp - Arg - Ile - Ser - Ser - Ser - Ser - Gly - Leu - Gly - Cys - Lys - Val - Leu - Arg - Arg - His - OH (Disulfide bridge: 10 - 26)

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top