Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

Chlorotoxin (Cltx)

Home/Catalog peptide/Chlorotoxin (Cltx)
Chlorotoxin (Cltx)Admin2021-01-07T06:34:36+00:00
Product Name Chlorotoxin (Cltx)
Purity HPLC>95%
Description A 36 amino acid chloride channel blocker
Storage -20°C
References Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
Molecular Weight 3996
Sequence (One-Letter Code) MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Sequence (Three-Letter Code) H - Met - Cys - Met - Pro - Cys - Phe - Thr - Thr - Asp - His - Gln - Met - Ala - Arg - Lys - Cys - Asp - Asp - Cys - Cys - Gly - Gly - Lys - Gly - Arg - Gly - Lys - Cys - Tyr - Gly - Pro - Gln - Cys - Leu - Cys - Arg - NH2 (Disulfide bridge: 2 - 19,5 - 28,16 - 33,20 - 35)

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top