| Product Name | GLP-1(9-36), amide, human |
| Purity | HPLC>95% |
| Description | GLP-1 (9-36) is the product of rapid degradation of GLP-1 (7-36) amide by dipeptidyl peptidase IV (DPP-4). It is widely expressed in many places, including the endothelial cells of small intestinal arteries. GLP-1 (9-36) accounts for the majority of GLP-1 entering the systemic circulation. Although GLP-1(7-36)amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide has no effect on human glucose clearance or insulin secretion. GLP-1 (9-36) amide has a protective effect on the heart of rodents. |
| Storage | -20°C |
| References | John, H. et al. Eur J Med Res 13, 73 (2008) Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229 Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197 |
| Molecular Weight | 3089.5 |
| Sequence (One-Letter Code) | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Sequence (Three-Letter Code) | H - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2 |
GLP-1(9-36), amide, humanAdmin2021-01-07T07:15:25+00:00