| Product Name | Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human |
| Purity | HPLC>95% |
| Description | This GLP-1(7-36) amide contains an additional lysine (K) residue at its n-terminus, and biotin is coupled to the lysine side chain. GLP-1(7-36)amide is an insulin-stimulating hormone that can cause glucose-dependent release of insulin by pancreatic cells. It is a cleavage product of GLP-1(1-36) amide peptide. GLP-1 (7-36) and GLP-1 (7-37) are also involved in gastric motility (gastric emptying), suppression of plasma glucagon levels (glucose production), and may promote the periphery without the action of insulin Tissues play a role in satiety and stimulation of glucose processing. GLP-1(7-36) has a short half-life of less than 2 minutes. Like GIP, it can be rapidly degraded by dipeptidyl peptidase IV (DPP-4) and is widely expressed in many sites, including endothelial cells in small intestinal arteries. . DPP-4 degrades GLP-1 (7-36) into non-insulin GLP-1 (9-36) (some studies indicate that it may have weaker insulin activity). As a result, the vast majority of GLP-1 (and GIP) are inactivated as insulin growth promoters before entering the systemic circulation. |
| Storage | -20°C |
| References | Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987) Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999) Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160 Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7 Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229 Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197 |
| Molecular Weight | 3551.8 |
| Sequence (One-Letter Code) | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2 |
| Sequence (Three-Letter Code) | H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Lys(Biotin) - NH2 |
Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, humanAdmin2021-01-07T08:40:16+00:00