| Product Name | PACAP (6-38), amide, human, ovine, rat |
| Purity | HPLC>95% |
| Description | This peptide is a potent antagonist of pacap38 and is more effective and selective than PACAP (6-27) in inhibiting the pituitary adenylate cyclase stimulated by PACAP-27. The Ki values of enzyme inhibition were 7nM and 150nm, respectively. |
| Storage | -20°C |
| References | Ref: Robberecht, P. et al. Eur. J. Biochem. 207, 239 (1992). |
| Molecular Weight | 4024.8 |
| Sequence (One-Letter Code) | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
| Sequence (Three-Letter Code) | H - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2 |
PACAP (6-38), amide, human, ovine, ratAdmin2021-01-08T04:29:46+00:00
