Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN
  • Home
  • About us
  • Custom Services
    • Custom Peptide Synthesis
      • Peptide Modification
      • Peptide Array
      • Peptide Library
    • Custom Antibody Services
      • Monoclonal Antibody Services
      • Polyclonal Antibody Services
    • Custom DNA/RNA Synthesis
      • siRNA
      • miRNA
    • Analytical Services
  • Products
    • Research Peptides
      • Beta Amyloid Peptides
      • Amylins (IAPP) Peptide Fragments
      • Antimicrobial Peptides
      • Catalog peptide
    • Antibodies
      • Primary Antibodies
      • Secondary Antibodies
    • API and Impurity
    • Inhibitor and Agonist
  • Technology transfer
  • Support
    • FAQ’s
  • CN/EN

Tau Peptide (306-336) (Repeat 3 domain)

Home/Catalog peptide/Tau Peptide (306-336) (Repeat 3 domain)
Tau Peptide (306-336) (Repeat 3 domain)Admin2021-01-17T07:26:43+00:00
Product Name Tau Peptide (306-336) (Repeat 3 domain)
Purity HPLC>95%
Description TAU protein belongs to the microtubule-associated protein (MAP) family and is related to the pathogenesis of Alzheimer's disease. In the human brain, there are 6 TAU subtypes, ranging in length from 352 to 441 amino acids. In addition to the presence or absence of one or two insertion domains at the amino terminus, these isoforms also vary at the carboxy terminus based on the presence of three repeat (3R) or four repeat (R4) domains. Tau peptide (306-336) is a 31 amino acid long peptide derived from repeat 3 domains.
Storage -20°C
References Buee, L. et al. Brain Res Rev 33 95 (2000). Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
Molecular Weight 3248
Sequence (One-Letter Code) VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Sequence (Three-Letter Code) Val - Gln - Ile - Val - Tyr - Lys - Pro - Val - Asp - Leu - Ser - Lys - Val - Thr - Ser - Lys - Cys - Gly - Ser - Leu - Gly - Asn - Ile - His - His - Lys - Pro - Gly - Gly - Gly - Gln - OH

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • elisa@bestbiochem.com
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: info@bestbiochem.com

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top