Skip to content
Best Biochem | Custom Peptide | Protein | Antibody | RNA oligos | Inhibitor Logo
  • About us
    • Home
  • About us
    • Home

VIP, human, porcine, rat

Home/Catalog peptide/VIP, human, porcine, rat
VIP, human, porcine, ratAdmin2021-01-05T06:08:17+00:00
Product Name VIP, human, porcine, rat
Purity HPLC>95%
Description 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator. VIP is broadly distributed in the peripheral and central nervous systems. It has an amino acid sequence identity of 68% with pituitary adenylate cyclase-activating polypeptide (PACAP). VIP and PACAP inhibit TNF-a, IL-1ß, IL-6, and NO production by lipopolysaccharide (LPS)-activated microglia. Both regulate the production of proinflammatory factors at a transcriptional level by inhibiting p65 nuclear translocation and nuclear factor-kB-DNA binding. As well, VIP relaxes the smooth muscle of the respiratory, gastrointestinal and reproductive tracts, stimulates exocrine and endocrine secretion, increases the survival time of neurons, and promotes the proliferation of untransformed and cancer cells.
Storage -20°C
References Paul, S. et al. J Biol Chem 276, 28314 (2001) Paul, S. et al. J Biol Chem 266,16128 (1991) Delgado, M. et al. J. Leukocyte Biol 73, 155 (2003) Yamamoto, K. et al. Diabetes 52, 1155 (2003) Ganea, D. Cell Mol Biol (Noisy-le-grand) 49, 127 (2003) Poso, D. and M. Delgado, FASEB J 18, 1325 (2004) Romano, D. et al. J Biol Chem 278, 51386 (2003).
Molecular Weight 3325.9
Sequence (One-Letter Code) HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence (Three-Letter Code) H - His - Ser - Asp - Ala - Val - Phe - Thr - Asp - Asn - Tyr - Thr - Arg - Leu - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Asn - Ser - Ile - Leu - Asn - NH2

Other Products

  • Research peptides
  • Antibodies
  • Drug for research
  • Inhibitor and agonist

Related Products

Beta-Amyloid (1-42), Human

Beta-Amyloid (1-42), FAM-labeled, Human

Amylin (1-37), rat, mouse

Amylin (1-37), human, amide

rCRAMP

LL-37 Citrulline

β-Defensin 2 (human)

Contact us
  • Skype: elisa.qiujx
  • [email protected]
  • WeChat

  • QQ: 1652852700

CUSTOM SERVICES

  • Peptide Synthesis
  • Antibody Production
  • DNA/RNA Synthesis

CHARACTERISTIC PRODUCTS

  • Research Peptide
  • Antibody
  • API and Impurity
  • Inhibitor and Agonist

Contact Info

No. 199 Huayuan Dong Road, Wuzhong Qu,Suzhou Shi, Jiangsu Sheng, China

Phone: +86 18021243762 (same as Wechat)

Email: [email protected]

Web: bestbiochem.com

Recent Tweets

Copyright 2012 - 2017 BestBiochem | All Rights Reserved
LinkedInFacebookTwitter
Go to Top