| Product Name | LL-37, Antimicrobial Peptide, human |
| Purity | HPLC>95% |
| Description | Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. |
| Storage | -20°C |
| References | Dürr, UHN. et al. Biochim. Biophys. Acta 1758, 1408 (2006); Neville, F. et al. Biophys. J. 90, 1275 (2006); Oren, Z. et al. Biochem. J. 341, 501(1999). |
| Molecular Weight | 4493.3 |
| Sequence (One-Letter Code) | [LL-37, 37 aa] |
| Sequence (Three-Letter Code) | H - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH |
Other Products
Related Products
